PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn302621
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 972aa    MW: 108194 Da    PI: 7.2108
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn302621genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822133.42.4e-41722112133
      DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl.eeaeaagssas...aspess 93 
                 g +r ++ +E+E++k RER+RRa++aki+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +g++p   ++++  +sas     ++++
  Achn302621  72 GVRRCRPVEEKERTKIRERQRRAVTAKILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsssQGTRPAgGTSATPLTSASshvPMQQNP 170
                 6789999*************************************************************9666666666733333333333223333333 PP

      DUF822  94 lq.sslkssalaspvesysaspksssfpspssldsislasa 133
                 +  ++   s  +s +e+ ++ +k + +p +s +d  s++ +
  Achn302621 171 SAsLRGICSGNKSSAENNACHMKGVFVPTSSPYDVSSSSRS 211
                 33366777888999999999999999999999998877543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.8E-3674202IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514454.12E-180256692IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.804.2E-197257707IPR013781Glycoside hydrolase, catalytic domain
PfamPF013738.1E-102263680IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65294308IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65315333IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65337358IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.7E-5420429IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007502.7E-65430452IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65503522IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65537553IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65554565IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65572595IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-65612634IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.7E-5663677IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008422.7E-5678692IPR001371Glycoside hydrolase, family 14B, plant
PfamPF011581.5E-29896962IPR000509Ribosomal protein L36e
PROSITE patternPS011900916926IPR000509Ribosomal protein L36e
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MTTEMQRFGT SEDDDEDMGM GVKEEDDDDD DEEKNNGTPI MVGLDGGLAS STNNNRFHQH  60
QQYQDQPTPQ AGVRRCRPVE EKERTKIRER QRRAVTAKIL AGLRRHGNYN LRVRADINDV  120
IAALAREAGW VVLPDGTTFP SSSQGTRPAG GTSATPLTSA SSHVPMQQNP SASLRGICSG  180
NKSSAENNAC HMKGVFVPTS SPYDVSSSSR SQMAAMVAAG GEGAQNYPLI AGSMDTVDNR  240
QVVDIPQKLQ ERDLAGTPYI PVYVMLPLGV INMKCELVDP DGLVKQLRIL KSINVDGVMV  300
DCWWGIVEAH TPQDYNWNGY KRLFQMVHEL KLKLQVVLSF HECGGNIGDD VCIPLPHWVA  360
EIGRSNPDIF FTDREGRRNP ECLSWGIDKE RVLRGRTAVE VYFDYMRSFR VEFDEFFEDG  420
IISIIEVGLG PCGELRYPSN PVKHGWRYPG VGEFQCYDQY LLKNLRKAAE ARGHSFWARG  480
PDNAGSYNSQ PHETGFFCDG GDYDGYYGRF FLNWYSQVLV DHGDRVLTLA KLAFEGTCIA  540
AKLSGIYWWN KTASHAAELT AGFYNPCNRD GYAAIMALLK KHGSALNFTC AEWGLLDHHV  600
DFPGALADPE GLAWHVLNAA WDVCIPVASE NALPCHDREG YNKISERAKP LNDPDGRHFC  660
AFTYLRLGAV LLERPNFVEF ERFVKRMHGN NRPVGQTSNL MNLSRIQIRK LIIEAMAARV  720
AILGDDITLF LWWNCIDLSR GDATWRNAHS EEVAAGSCVA MPCGEAPLNE GWLSSHLVLP  780
QGGAKFTYLQ LSTCLDGDCN LVLVLVAVMF HGLSYRYLAQ NGEATIVLVK CNMDLKDVGS  840
MSSLVEPDGG RRDQNETLDC SEDFPRKSSQ ELTGRWCLFG VVIVVKLNSS IVAVMKTSKR  900
IHFVRGLIRE VAGFAPYEKR ITELLKVGKD KRALKVAKRK LGTHKRAKKK REEMSNVLRK  960
MRSAGGGEKK K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ukp_A1e-14525969011444Beta-amylase
1ukp_B1e-14525969011444Beta-amylase
1ukp_C1e-14525969011444Beta-amylase
1ukp_D1e-14525969011444Beta-amylase
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1938949RKLGTHKRAKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7394630.0KP739463.1 Camellia sinensis beta-amylase 7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273843.10.0PREDICTED: beta-amylase 7
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A0K0PUB30.0A0A0K0PUB3_CAMSI; Beta-amylase
STRINGVIT_15s0046g02640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7